General Information

  • ID:  hor000918
  • Uniprot ID:  A7XZR3(61-98)
  • Protein name:  Cholecystokinin
  • Gene name:  NA
  • Organism:  Sylvirana nigrovittata (Black-striped frog) (Hylarana nigrovittata)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sylvirana (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RVDGNSDQKAVIGAMLAKDLQTRKAGSSTGRYAVLPNR
  • Length:  38(61-98)
  • Propeptide:  MYSGICICVLLAVLSASSTGQQTVGSMNEDPGAREIEQQNILQHPRHIRASSSAQLKPFQRVDGNSDQKAVIGAMLAKDLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
  • Signal peptide:  MYSGICICVLLAVLSASSTG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A7XZR3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000918_AF2.pdbhor000918_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 470575 Formula: C170H291N57O55S
Absent amino acids: CEFHW Common amino acids: A
pI: 11.07 Basic residues: 7
Polar residues: 12 Hydrophobic residues: 12
Hydrophobicity: -60.79 Boman Index: -9537
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 77.11
Instability Index: 2180.53 Extinction Coefficient cystines: 1490
Absorbance 280nm: 40.27

Literature

  • PubMed ID:  17698250
  • Title:  Isolation and cDNA Cloning of Cholecystokinin From the Skin of Rana Nigrovittata